PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 233aa    MW: 27080.4 Da    PI: 9.684
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619564.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.6e-19449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+d+v+q+G+++W++Ia +++ gR++k+c++rw++ 
   XP_013619564.1  4 RGHWRPAEDEKLKDLVEQYGPHNWNAIALKLP-GRSGKSCRLRWFNQ 49
                     899*****************************.***********996 PP

2Myb_DNA-binding60.63.3e-195699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
   XP_013619564.1 56 RNPFTEEEEERLLAAHRIHGNR-WSIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.673150IPR017930Myb domain
SMARTSM007171.1E-15352IPR001005SANT/Myb domain
SuperFamilySSF466893.26E-30497IPR009057Homeodomain-like
PfamPF002491.8E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-27557IPR009057Homeodomain-like
CDDcd001676.41E-15748No hitNo description
PROSITE profilePS5129426.37951105IPR017930Myb domain
SMARTSM007171.9E-1655103IPR001005SANT/Myb domain
PfamPF002497.5E-165698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2158104IPR009057Homeodomain-like
CDDcd001679.88E-85898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MCSRGHWRPA EDEKLKDLVE QYGPHNWNAI ALKLPGRSGK SCRLRWFNQL DPRINRNPFT  60
EEEEERLLAA HRIHGNRWSI IARLFPGRTD NAVKNHWHVI MARRTRQTSK PRILTSTTSS  120
LLATDQIMMA SGDRKRILGD GIGYAYQFSH INHLQFLEEF FTQKIAFNTK DAMVANQSKK  180
PVEFYNFLQV DMDSNKSENI DQDSDQSNPH DSDNKKESRV PFFDFLSVKN STS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-3211051105C-Myb DNA-Binding Domain
1msf_C5e-3211051105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628901e-127AF062890.1 Arabidopsis thaliana putative transcription factor (MYB54) mRNA, complete cds.
GenBankAK2274021e-127AK227402.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-06-B21.
GenBankAY5195691e-127AY519569.1 Arabidopsis thaliana MYB transcription factor (At1g73410) mRNA, complete cds.
GenBankBT0248511e-127BT024851.1 Arabidopsis thaliana At1g73410 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619564.11e-177PREDICTED: transcription factor WER-like
TrEMBLA0A0D3AQB81e-177A0A0D3AQB8_BRAOL; Uncharacterized protein
STRINGBra008096.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.11e-128myb domain protein 54